Recombinant Human S100-A7 Protein
Product Sizes
10 ug
£133.00
RP01795-10UG
20 ug
£181.00
RP01795-20UG
50 ug
£240.00
RP01795-50UG
100 ug
£353.00
RP01795-100UG
500 ug
£1002.00
RP01795-500UG
1000 ug
£1574.00
RP01795-1000UG
About this Product
- SKU:
- RP01795
- Additional Names:
- PSOR1|S100-A7|S100A7|S100A7c
- Extra Details:
- Protein S100-A7, also known as S100 calcium-binding protein A7, Psoriasin, S100A7, and PSOR1, is a secreted protein which belongs to theS-100 family. S100A7 was first isolated from skin involved by psoriasis, which can be induced in cultured squamous epithelial cells. S100A7 is expressed by both normal cultured and malignant keratinocytes and malignant breast epithelial cells within ductal carcinoma in situ, suggesting an association with abnormal pathways of differentiation. S100A7 plays a role in the pathogenesis of inflammatory skin disease, as a chemotactic factor for hematopoietic cells. It also plays a role in early stages of breast tumor progression in association with the development of the invasive phenotype.
- Formulation:
- Recombinant Human S100-A7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2-Gln101) of human S100-A7 (Accession #NP_002954.2) fused with a hFc
- Immunogen:
- Ser2-Gln101
- Molecular Weight:
- 45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01795
