Recombinant Rat c-Kit ligand/KITLG/SCF Protein
Product Sizes
10 ug
£133.00
RP01794-10UG
20 ug
£181.00
RP01794-20UG
50 ug
£240.00
RP01794-50UG
100 ug
£353.00
RP01794-100UG
About this Product
- SKU:
- RP01794
- Additional Names:
- c-Kit ligand|Kitl|Mgf|SCF
- Extra Details:
- Recombinant Rat c-Kit ligand/KITLG/SCF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Ala189) of rat c-Kit ligand/SCF/KITLG (Accession #NP_068615.1) fused with 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln26-Ala189
- Molecular Weight:
- 19.17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01794
