Recombinant Human MYDGF Protein
Product Sizes
10 ug
£133.00
RP01790-10UG
20 ug
£181.00
RP01790-20UG
50 ug
£240.00
RP01790-50UG
100 ug
£353.00
RP01790-100UG
500 ug
£1002.00
RP01790-500UG
1000 ug
£1574.00
RP01790-1000UG
About this Product
- SKU:
- RP01790
- Additional Names:
- MYDGF, C19orf10,Myeloid-derived growth factor, MYDGF
- Extra Details:
- Myeloid-Derived Growth Factor, or MYDGF, is a Bone marrow-derived monocyte protein, and it is correlated with enhanced metabolic activity, suppression of apoptosis, and stimulation of cell proliferation . MYDGF is expressed predominantly in inflammatory cells, such as monocytes and macrophages . Up-regulation of MYDGF expression was also found during adipocyte differentiation . Expression of MYDGF was induced in the circulation and heart tissue after myocardial infarction. It promotes cardiac myocyte survival by stimulating endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway, and inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway . MYDGF was found over-expressed in approximately two-thirds of Hepatocellular Carcinoma (HCC) tissues, and its expression was significantly positively correlated with that of alpha-fetoprotein (AFP) .
- Formulation:
- Recombinant Human MYDGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Leu173) of human MYDGF (Accession #NP_061980.1) fused with a 6xHis t
- Immunogen:
- Val32-Leu173
- Molecular Weight:
- 18-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01790
