Recombinant Rat IL-3 Protein
Product Sizes
10 ug
£145.00
RP01789-10UG
20 ug
£193.00
RP01789-20UG
50 ug
£288.00
RP01789-50UG
100 ug
£431.00
RP01789-100UG
500 ug
£1240.00
RP01789-500UG
1000 ug
£1954.00
RP01789-1000UG
About this Product
- SKU:
- RP01789
- Additional Names:
- IL-3|IL3
- Extra Details:
- IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
- Formulation:
- Recombinant Rat IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Cys169) of rat IL-3 (Accession #NP_113701.1) fused with a 6xHis tag at
- Immunogen:
- Ile27-Cys169
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01789


