Recombinant Rat IL-1 beta Protein
Product Sizes
10 ug
£145.00
RP01788-10UG
20 ug
£193.00
RP01788-20UG
50 ul
£288.00
RP01788-50UL
100 ul
£431.00
RP01788-100UL
500 ug
£1240.00
RP01788-500UG
1000 ug
£1954.00
RP01788-1000UG
About this Product
- SKU:
- RP01788
- Additional Names:
- IL-1 beta,IL1B,IL-1BETA,IL1F2,IL-1B Beta,il1b,IL1B|IL-1F2
- Extra Details:
- Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Formulation:
- Recombinant Rat IL-1 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val117-Ser268) of rat IL-1 beta (Accession #NP_113700.2) fused with a 6x
- Immunogen:
- Val117-Ser268
- Molecular Weight:
- 18-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01788
