Recombinant Human CCL21/6Ckine Protein
Product Sizes
10 ug
£145.00
RP01781-10UG
20 ug
£193.00
RP01781-20UG
50 ug
£288.00
RP01781-50UG
100 ug
£431.00
RP01781-100UG
About this Product
- SKU:
- RP01781
- Additional Names:
- CCL21,6Ckine,CKb9,SCYA21
- Extra Details:
- Recombinant Human CCL21/6Ckine Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Pro134) of human CCL21/6Ckine (Accession #NP_002980.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser24-Pro134
- Molecular Weight:
- 12.25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01781
