Recombinant Human TGF-alpha Protein
Product Sizes
10 ug
£133.00
RP01780-10UG
20 ug
£181.00
RP01780-20UG
50 ug
£240.00
RP01780-50UG
100 ug
£353.00
RP01780-100UG
About this Product
- SKU:
- RP01780
- Additional Names:
- TFGA|TGF-alpha
- Extra Details:
- Recombinant Human TGF-alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val40-Ala89) of human TGF-alpha/TGFA (Accession #NP_003227.1) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM Tris, 100mM NaCl, pH8.0
- Immunogen:
- Val40-Ala89
- Molecular Weight:
- 5.55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01780
