Recombinant Human TGF-alpha Protein
Product Sizes
10 ug
£133.00
RP01780-10UG
20 ug
£181.00
RP01780-20UG
50 ug
£240.00
RP01780-50UG
100 ug
£353.00
RP01780-100UG
500 ug
£1002.00
RP01780-500UG
1000 ug
£1574.00
RP01780-1000UG
About this Product
- SKU:
- RP01780
- Additional Names:
- TFGA|TGF-alpha
- Extra Details:
- The miR-137 served as a tumor suppressor in non-small cell lung cancer (NSCLC) and its suppressive effect is mediated by repressing TGFA expression. TGFA gene expression was significantly higher in tumor tissues compared to adjacent normal tissue and high TGFA gene expression strongly correlated with poor survival in patients with lung adenocarcinoma, and miR-374a suppresses lung adenocarcinoma cell proliferation and invasion via targeting TGFA gene expression. Transforming growth factor alpha (TGFA) is a well-characterized mammalian growth factor that might contribute to the development of Cleft lip and palate (CL/P).
- Formulation:
- Recombinant Human TGF-alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val40-Ala89) of human TGF-alpha/TGFA (Accession #NP_003227.1) fused with no
- Immunogen:
- Val40-Ala89
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01780
