Recombinant Human TNFSF13/APRIL/CD256 Protein
Product Sizes
10 ug
£145.00
RP01777-10UG
20 ug
£193.00
RP01777-20UG
50 ug
£288.00
RP01777-50UG
100 ug
£431.00
RP01777-100UG
500 ug
£1240.00
RP01777-500UG
1000 ug
£1954.00
RP01777-1000UG
About this Product
- SKU:
- RP01777
- Additional Names:
- APRIL|CD256|TALL-2|TALL2|TNFSF13|TNLG7B|TRDL-1|UNQ383/PRO715|ZTNF2
- Extra Details:
- TNFSF13 is a member of the tumor necrosis factor (TNF) ligand family. It is a ligand for TNFRSF17/BCMA. TNFSF13 is lowly expressed in normal tissues, but is elevated in several types of tumors and transformed cell lines. It is important for B cell development. TNFSF13 may also play a role in T-independent type II antigen responses and T cell survival, and induce proliferation/survival of non lymphoid cells. It exists as a functional homotrimer. It can bind to two cell surface receptors, BCMA and TACI, which it shares with BAFF to exert downstream T- and B-cell regulatory effects. TNFSF13 also has been demonstrated to bind to proteoglycans on the cell surface.
- Formulation:
- Recombinant Human TNFSF13/APRIL/CD256 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys111-leu250) of human TNFSF13 (Accession #NP_001185552.1)
- Immunogen:
- Lys111-leu250
- Molecular Weight:
- 50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01777
