Recombinant Human CXCL4/PF-4 Protein

Product Sizes

10 ug

£145.00

RP01774-10UG

20 ug

£193.00

RP01774-20UG

50 ug

£336.00

RP01774-50UG

500 ug

£1240.00

RP01774-500UG

1000 ug

£1954.00

RP01774-1000UG

About this Product

SKU:: RP01774
Additional Names:: CXCL4|PF-4|SCYB4
Extra Details:: CXCL4, or Platelet factor 4 (PF4), is a small cytokine belonging to the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. CXCL4 is chemotactic for neutrophils and monocytes and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. CXCL4/PF4 is up-regulated in human liver fibrosis and that it plays a nonredundant, functional role in experimental liver fibrosis by mediating stellate cell proliferation, migration, and intrahepatic immune cell recruitment.
Formulation:: Recombinant Human CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu32-Ser101) of human PF-4/CXCL4/SCYB4 (Accession #NP_002610.1) fuse
Immunogen:: Glu32-Ser101
Molecular Weight:: 10-15 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket