Recombinant Human CXCL4/PF-4 Protein
Product Sizes
10 ug
£145.00
RP01774-10UG
20 ug
£193.00
RP01774-20UG
About this Product
- SKU:
- RP01774
- Additional Names:
- CXCL4|PF-4|SCYB4
- Extra Details:
- Recombinant Human CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu32-Ser101) of human PF-4/CXCL4/SCYB4 (Accession #NP_002610.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 10 mM Sodium Citrate,150 mM NaCl,pH5.0 .
- Immunogen:
- Glu32-Ser101
- Molecular Weight:
- 8.61 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01774
