Recombinant Human PDGF-AA Protein
Product Sizes
10 ug
£145.00
RP01772-10UG
20 ug
£193.00
RP01772-20UG
50 ug
£288.00
RP01772-50UG
100 ug
£431.00
RP01772-100UG
500 ug
£1478.00
RP01772-500UG
1000 ug
£2335.00
RP01772-1000UG
About this Product
- SKU:
- RP01772
- Additional Names:
- PDGF-A|PDGF1
- Extra Details:
- Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
- Formulation:
- Recombinant Human PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Thr211) of human PDGF-AA (Accession #NP_002598.4) fused with no addition
- Immunogen:
- Ser87-Thr211
- Molecular Weight:
- 20 kDa kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01772
