Recombinant Human MMP-7 Protein
Product Sizes
10 ug
£163.00
RP01770LQ-10UG
20 ug
£223.00
RP01770LQ-20UG
50 ug
£336.00
RP01770LQ-50UG
100 ug
£508.00
RP01770LQ-100UG
About this Product
- SKU:
- RP01770LQ
- Additional Names:
- MMP7, MPSL1, PUMP1,Matrilysin, Matrix metalloproteinase-7, MMP-7
- Extra Details:
- Recombinant Human MMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr97-Lys267) of human MMP7 (Accession #NP_002414.1) fused with hFc tag at the C-terminus.
- Formulation:
- Supplied as a 0.22 um filtered solution in 10mM HEPES 150mM NaCl 10%glycerol PH7.5.
- Immunogen:
- Tyr95-Lys267
- Molecular Weight:
- 45.09 kDa
- Purity:
- ≥95%
- Sequence:
- YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01770LQ
