Recombinant Mouse IL-7 Protein
Product Sizes
50 ug
£383.00
RP01766-50UG
100 ug
£586.00
RP01766-100UG
About this Product
- SKU:
- RP01766
- Additional Names:
- A630026I06Rik; il7|hlb368|Il-7
- Extra Details:
- Recombinant Mouse IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-Ile154) of mouse IL-7 (Accession #NP_032397.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu26-Ile154
- Molecular Weight:
- 15.74 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01766
