Recombinant Mouse IL-7 Protein
Product Sizes
10 ug
£193.00
RP01766-10UG
20 ug
£265.00
RP01766-20UG
50 ug
£383.00
RP01766-50UG
100 ug
£586.00
RP01766-100UG
500 ug
£1716.00
RP01766-500UG
1000 ug
£2716.00
RP01766-1000UG
About this Product
- SKU:
- RP01766
- Additional Names:
- A630026I06Rik; il7|hlb368|Il-7
- Extra Details:
- IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.
- Formulation:
- Recombinant Mouse IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-Ile154) of mouse IL-7 (Accession #NP_032397.1) fused with a 6xHis tag
- Immunogen:
- Glu26-Ile154
- Molecular Weight:
- 20-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01766
