Recombinant Mouse IL-36 gamma/IL-1F9 Protein
Product Sizes
10 ug
£163.00
RP01762-10UG
20 ug
£223.00
RP01762-20UG
50 ug
£336.00
RP01762-50UG
100 ug
£508.00
RP01762-100UG
About this Product
- SKU:
- RP01762
- Additional Names:
- If36g|IL-36gamma|Il1f9
- Extra Details:
- Recombinant Mouse IL-36 gamma/IL-1F9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly13-Ser164) of mouse IL36G (Accession #) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly13-Ser164
- Molecular Weight:
- 18.17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01762
