Recombinant Rat FGF-2/bFGF Protein
Product Sizes
10 ug
£145.00
RP01759-10UG
20 ug
£193.00
RP01759-20UG
50 ug
£288.00
RP01759-50UG
100 ug
£431.00
RP01759-100UG
About this Product
- SKU:
- RP01759
- Additional Names:
- bFGF|Fgf-2|FGF2|Fgf2a
- Extra Details:
- Recombinant Rat FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala11-Ser154) of rat FGF-2/bFGF (Accession #NP_062178.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala11-Ser154
- Molecular Weight:
- 17.05 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01759




