Recombinant human IL-25/IL-17E Protein
Product Sizes
10 ug
£145.00
RP01755-10UG
20 ug
£193.00
RP01755-20UG
50 ug
£288.00
RP01755-50UG
About this Product
- SKU:
- RP01755
- Additional Names:
- IL-25|IL17E
- Extra Details:
- Recombinant human IL-25/IL-17E Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr33-Gly177) of human IL-25(Accession #NP_073626.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20 mM Tris,150 mM NaCl,1 mM EDTA,pH8.0
- Immunogen:
- Tyr33-Gly177
- Molecular Weight:
- 17.58 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01755
