Recombinant Mouse TNFSF13/APRIL/CD256 Protein
Product Sizes
10 ug
£133.00
RP01753-10UG
20 ug
£181.00
RP01753-20UG
50 ug
£240.00
RP01753-50UG
100 ug
£353.00
RP01753-100UG
500 ug
£1002.00
RP01753-500UG
1000 ug
£1574.00
RP01753-1000UG
About this Product
- SKU:
- RP01753
- Additional Names:
- 2310026N09Rik; TNFSF13; CD256|April|Tall2|Tnlg7b|Trdl1
- Extra Details:
- TNFSF13 is a member of the tumor necrosis factor (TNF) ligand family. It is a ligand for TNFRSF17/BCMA. TNFSF13 is lowly expressed in normal tissues, but is elevated in several types of tumors and transformed cell lines. It is important for B cell development. TNFSF13 may also play a role in T-independent type II antigen responses and T cell survival, and induce proliferation/survival of non lymphoid cells. It exists as a functional homotrimer. It can bind to two cell surface receptors, BCMA and TACI, which it shares with BAFF to exert downstream T- and B-cell regulatory effects. TNFSF13 also has been demonstrated to bind to proteoglycans on the cell surface.
- Formulation:
- Recombinant Mouse TNFSF13/APRIL/CD256 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys104-Leu241) of mouse TNFSF13/APRIL/CD256 (Accession #NP_0
- Immunogen:
- Lys104-Leu241
- Molecular Weight:
- 50-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01753
