Recombinant Mouse PDGF-BB Protein
Product Sizes
10 ug
£145.00
RP01745-10UG
20 ug
£193.00
RP01745-20UG
50 ug
£288.00
RP01745-50UG
About this Product
- SKU:
- RP01745
- Additional Names:
- c-sis|PDGF-2|PDGF-B; PDGFB|Sis
- Extra Details:
- Recombinant Mouse PDGF-BB Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser82-Thr190) of mouse PDGF subunit B/PDGF-2/PDGFB (Accession #NP_035187.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mMNaAc-Hac pH4.5
- Immunogen:
- Ser82-Thr190
- Molecular Weight:
- 13.06 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01745
