Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein
Product Sizes
10 ug
£145.00
RP01744-10UG
20 ug
£193.00
RP01744-20UG
50 ug
£288.00
RP01744-50UG
100 ug
£431.00
RP01744-100UG
500 ug
£1240.00
RP01744-500UG
1000 ug
£1954.00
RP01744-1000UG
About this Product
- SKU:
- RP01744
- Additional Names:
- Agpt2|Ang-2|Ang2
- Extra Details:
- Angiopoietin-2 (ANG 2, or ANGPT2), is a member of the ANG family, which plays an important role in angiogenesis during the development and growth of human cancers. Both ANGPT-1 and ANGPT-2 appear to bind to the tyrosine kinase receptor, Tie-2, found primarily on the luminal surface of endothelial cells. ANG-2's role in angiogenesis generally is considered as an antagonist for ANG1, inhibiting ANG1-promoted Tie2 signaling, which is critical for blood vessel maturation and stabilization
- Formulation:
- Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys275-Phe496) of mouse Angiopoietin-2/ANG-
- Immunogen:
- Lys275-Phe496
- Molecular Weight:
- 35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01744
