Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein
Product Sizes
10 ug
£145.00
RP01743-10UG
20 ug
£193.00
RP01743-20UG
50 ug
£288.00
RP01743-50UG
100 ug
£431.00
RP01743-100UG
About this Product
- SKU:
- RP01743
- Additional Names:
- 1110046O21Rik|Ang-1|Ang1
- Extra Details:
- Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg277-Phe498) of mouse Angiopoietin-1/ANG-1/ANGPT1 (Accession #NP_033770.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg277-Phe498
- Molecular Weight:
- 26.49 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01743




