Recombinant Rat IL-1 alpha Protein
Product Sizes
10 ug
£163.00
RP01736-10UG
20 ug
£223.00
RP01736-20UG
50 ug
£336.00
RP01736-50UG
100 ug
£508.00
RP01736-100UG
About this Product
- SKU:
- RP01736
- Additional Names:
- IL-1 alpha|IL-1F1|IL-1A Alpha
- Extra Details:
- Recombinant Rat IL-1 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser115-Ser270) of rat IL-1 alpha/Il1a (Accession #) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser115-Ser270
- Molecular Weight:
- 18.63 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01736
