Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein
Product Sizes
10 ug
£145.00
RP01734-10UG
20 ug
£193.00
RP01734-20UG
50 ug
£288.00
RP01734-50UG
100 ug
£431.00
RP01734-100UG
About this Product
- SKU:
- RP01734
- Additional Names:
- CD154|CD40-L|Cd40l|CD40LG|gp39|HIGM1|IGM|IMD3|Ly-62|Ly62|T-BAM|Tnfsf5|Tnlg8b|TRAP
- Extra Details:
- Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly115-Leu260) of mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG (Accession #NP_035746.2) fused with and a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly115-Leu260
- Molecular Weight:
- 16.83 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01734
