Recombinant Mouse EPO-R/Epor Protein
Product Sizes
10 ug
£133.00
RP01732-10UG
20 ug
£181.00
RP01732-20UG
50 ug
£240.00
RP01732-50UG
100 ug
£353.00
RP01732-100UG
500 ug
£1002.00
RP01732-500UG
1000 ug
£1574.00
RP01732-1000UG
About this Product
- SKU:
- RP01732
- Additional Names:
- EPO-R|Epor
- Extra Details:
- Erythropoietin (EPO) is the major glycoprotein hormone regulator of mammalian erythropoiesis, and is produced by kidney and liver in an oxygen-dependent manner. The biological effects of EPO are mediated by the specific erythropoietin receptor (EPOR/EPO Receptor) on bone marrow erythroblasts, which transmits signals important for both proliferation and differentiation along the erythroid lineage. EPOR protein is a type a..., single-transmembrane cytokine receptor, and belongs to the homodimerizing subclass which functions as ligand-induced or ligand-stabilized homodimers. EPOR signaling prevents neuronal death and ischemic injury. Recent studies have shown that EPO and EPOR protein may be involved in carcinogenesis, angiogenesis, and invasion.
- Formulation:
- Recombinant Mouse EPO-R/Epor Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Pro249) of mouse EPO-R/Epor (Accession #NP_034279.3) fused with
- Immunogen:
- Ala25-Pro249
- Molecular Weight:
- 30-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01732
