Recombinant Human Prolactin/PRL Protein
Product Sizes
10 ug
£127.00
RP01723-10UG
20 ug
£157.00
RP01723-20UG
50 ug
£223.00
RP01723-50UG
100 ug
£336.00
RP01723-100UG
500 ug
£1002.00
RP01723-500UG
1000 ug
£1574.00
RP01723-1000UG
About this Product
- SKU:
- RP01723
- Additional Names:
- GHA1|PRL|PRL,Prolactin,Gha1,Prl1a1,AV290867,PRL
- Extra Details:
- Prolactin (PRL) is a hormone with multiple actions in the central nervous system (CNS) spanning from physiology to pathology. PRL exerts different actions through its receptors that can be found in both neurons and glial cells (astrocytes, microglia and oligodendrocytes) of the brain. It is generally believed that in vertebrates, prolactin (PRL) is predominantly synthesized and released by pituitary lactotrophs and plays important roles in many physiological processes via activation of PRL receptor (PRLR), including water and electrolyte balance, reproduction, growth and development, metabolism, immuno-modulation, and behavior.
- Formulation:
- Recombinant Human Prolactin/PRL Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Cys227) of human Prolactin/PRL (Accession #NP_000939.1) fuse
- Immunogen:
- Leu29-Cys227
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01723
