Recombinant Human Prolactin/PRL Protein
Product Sizes
10 ug
£127.00
RP01723-10UG
20 ug
£157.00
RP01723-20UG
50 ug
£223.00
RP01723-50UG
100 ug
£336.00
RP01723-100UG
About this Product
- SKU:
- RP01723
- Additional Names:
- GHA1|PRL|PRL,Prolactin,Gha1,Prl1a1,AV290867,PRL
- Extra Details:
- Recombinant Human Prolactin/PRL Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Cys227) of human Prolactin/PRL (Accession #NP_000939.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu29-Cys227
- Molecular Weight:
- 23.74 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01723
