Recombinant Human CSF-3/G-CSF Protein
Product Sizes
10 ul
£145.00
RP01722-10UL
20 ug
£193.00
RP01722-20UG
50 ug
£288.00
RP01722-50UG
100 ug
£431.00
RP01722-100UG
About this Product
- SKU:
- RP01722
- Additional Names:
- C17orf33|CSF3|CSF3OS|GCSF
- Extra Details:
- Recombinant Human CSF-3/G-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Pro204) of human G-CSF/CSF3 (Accession #NP_757373.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Pro204
- Molecular Weight:
- 22.82 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01722








