Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Product Sizes
10 ug
£133.00
RP01720-10UG
20 ug
£181.00
RP01720-20UG
About this Product
- SKU:
- RP01720
- Additional Names:
- CD27-L|CD27L|CD27LG|CD70|LPFS3|TNFSF7|TNLG8A
- Extra Details:
- Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of human CD70/TNFSF7/CD27 Ligand (Accession #NP_001243.1) fused with and a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln39-Pro193
- Molecular Weight:
- 17.98 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01720
