Recombinant Mouse IFNA1 Protein
Product Sizes
10 ug
£133.00
RP01719-10UG
20 ug
£181.00
RP01719-20UG
50 ug
£240.00
RP01719-50UG
100 ug
£353.00
RP01719-100UG
500 ug
£1002.00
RP01719-500UG
1000 ug
£1574.00
RP01719-1000UG
About this Product
- SKU:
- RP01719
- Additional Names:
- If1ai14|Ifa1|IFNA1
- Extra Details:
- IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites, or tumor cells. They belong to the large class of glycoproteins known as cytokines. IFNs stimulate the production of two enzymes: a protein kinase and an oligoadenylate synthetase. They allow for communication between cells to trigger the protective defenses of the immune system that eradicate pathogens or tumors. IFNs can activate immune cells, such as natural killer cells and macrophages; they increase recognition of infection or tumor cells by up-regulating antigen presentation to T lymphocytes, and they also increase the ability of uninfected host cells to resist new infection by the virus. Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has antiviral activities.
- Formulation:
- Recombinant Mouse IFNA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Lys189) of mouse IFNA1 (Accession #NP_034632.2) fused with and a 6xH
- Immunogen:
- Cys24-Lys189
- Molecular Weight:
- 20-26 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01719
