Recombinant Human FGF-7/HBGF-7/KGF Protein
Product Sizes
10 ug
£145.00
RP01717-10UG
20 ug
£193.00
RP01717-20UG
50 ug
£288.00
RP01717-50UG
About this Product
- SKU:
- RP01717
- Additional Names:
- FGF7|HBGF-7|KGF
- Extra Details:
- Recombinant Human FGF-7/HBGF-7/KGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys32-Thr194) of human FGF-7/HBGF-7 (Accession #NP_002000.1) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Cys32-Thr194
- Molecular Weight:
- 19.72 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01717
