Recombinant human Ephrin-A3/EFNA3 Protein
Product Sizes
10 ug
£107.00
RP01714-10UG
20 ug
£133.00
RP01714-20UG
50 ug
£163.00
RP01714-50UG
100 ug
£240.00
RP01714-100UG
500 ug
£645.00
RP01714-500UG
1000 ug
£1002.00
RP01714-1000UG
About this Product
- SKU:
- RP01714
- Additional Names:
- EFL2|EFNA3|Ehk1-L|EPLG3|LERK3
- Extra Details:
- Ephrin-A3 (Ephrin A3) is also known as EFL-2, EHK1 ligand, EHK1-L, EPH-related receptor tyrosine kinase ligand 3, EFL2, EPLG3 and LERK3,which comprises the largest subfamily of receptor protein-tyrosine kinases (RTKs), and has been involved in a variety of biological processes, especially in the nervous system and in erythropoiesis, such as axon guidance and topographic map formation, synaptic plasticity, angiogenesis, and meanwhile have possible contributions to tumor growth and metastasis. Ephrin A3 is cell surface GPI-bound ligand for Eph receptors and belongs to the family of receptor tyrosine kinases. Ephrin can bind promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells.
- Formulation:
- Recombinant human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin-A3/EFNA3 (Accession #NP_004943.1.
- Immunogen:
- Met 1-Ser 213
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01714
