Recombinant Human FGF-4 Protein
Product Sizes
10 ug
£145.00
RP01712-10UG
20 ug
£193.00
RP01712-20UG
100 ug
£431.00
RP01712-100UG
About this Product
- SKU:
- RP01712
- Additional Names:
- FGF-4|FGF4|HBGF-4|HST|HST-1|HSTF-1|HSTF1|K-FGF|KFGF
- Extra Details:
- Recombinant Human FGF-4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly25-Leu206) of human FGF-4 (Accession #NP_001998.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly25-Leu206
- Molecular Weight:
- 19.76 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01712
