Recombinant Human CX3CL1/Fractalkine Protein
Product Sizes
10 ug
£145.00
RP01711-10UG
20 ug
£193.00
RP01711-20UG
50 ug
£288.00
RP01711-50UG
500 ug
£1240.00
RP01711-500UG
1000 ug
£1954.00
RP01711-1000UG
About this Product
- SKU:
- RP01711
- Additional Names:
- ABCD-3|C3Xkine|CXC3|CXC3C|fractalkine|neurotactin|NTN|NTT|SCYD1
- Extra Details:
- Fractalkine or Chemokine (C-X3-C motif) ligand 1 (CX3CL1) is a member of the CX3C chemokine family. Fractalkine / CX3CL1 is a unique chemokine that functions not only as a chemoattractant but also as an adhesion molecule and is expressed on endothelial cells activated by proinflammatory cytokines, such as interferon-gamma and tumor necrosis factor-alpha. Fractalkine/CX3CL1 is expressed in a membrane-bound form on activated endothelial cells and mediates attachment and firm adhesion of T cells, monocytes and NK cells. Fractalkine / CX3CL1 is associated with dendritic cells (DC) in epidermis and lymphoid organs. The fractalkine receptor, CX3CR1, is expressed on cytotoxic effector lymphocytes, including natural killer (NK) cells and cytotoxic T lymphocytes, which contain high levels of intracellular perforin and granzyme B, and on macrophages. Soluble fractalkine causes migration of NK cells, cytotoxic T lymphocytes, and macrophages, whereas the membrane-bound form captures and enhances the subsequent migration of these cells in response to secondary stimulation with other chemokines.
- Formulation:
- Recombinant Human CX3CL1/Fractalkine Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln25-Gly100) of human CX3CL1/Fractalkine (Accession #NP_002987.1)
- Immunogen:
- Gln25-Gly100
- Molecular Weight:
- 15, 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01711
