Recombinant Human CX3CL1/Fractalkine Protein
Product Sizes
10 ug
£145.00
RP01711-10UG
20 ug
£193.00
RP01711-20UG
50 ug
£288.00
RP01711-50UG
About this Product
- SKU:
- RP01711
- Additional Names:
- ABCD-3|C3Xkine|CXC3|CXC3C|fractalkine|neurotactin|NTN|NTT|SCYD1
- Extra Details:
- Recombinant Human CX3CL1/Fractalkine Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln25-Gly100) of human CX3CL1/Fractalkine (Accession #NP_002987.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln25-Gly100
- Molecular Weight:
- 9.47 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01711
