Recombinant Human FGF-9 Protein
Product Sizes
10 ug
£145.00
RP01710-10UG
20 ug
£193.00
RP01710-20UG
50 ug
£288.00
RP01710-50UG
100 ug
£431.00
RP01710-100UG
500 ug
£1240.00
RP01710-500UG
1000 ug
£1954.00
RP01710-1000UG
About this Product
- SKU:
- RP01710
- Additional Names:
- FGF-9|FGF9|GAF|HBFG-9|HBGF-9|SYNS3
- Extra Details:
- Fibroblast growth factor 9 (FGF9) also known as Glia-activating factor or Heparin-binding growth factor 9, is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells.
- Formulation:
- Recombinant Human FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Ser208) of human FGF-9 (Accession #NP_002001.1) fused with no additional a
- Immunogen:
- Ala2-Ser208
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01710
