Recombinant Human Proliferating cell nuclear antigen/PCNA Protein
Product Sizes
10 ug
£145.00
RP01706-10UG
20 ug
£193.00
RP01706-20UG
50 ug
£288.00
RP01706-50UG
100 ug
£431.00
RP01706-100UG
About this Product
- SKU:
- RP01706
- Additional Names:
- ATLD2; Proliferating cell nuclear antigen; PCNA
- Extra Details:
- Recombinant Human Proliferating cell nuclear antigen/PCNA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe2-Ser261) of human Proliferating cell nuclear antigen/PCNA (Accession #NP_002583.1) fused with N-HA&Strep tag at N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Phe2-Ser261
- Molecular Weight:
- 29.74 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- FEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01706
