Recombinant Human Betacellulin/BTC Protein
Product Sizes
10 ug
£145.00
RP01700-10UG
20 ug
£193.00
RP01700-20UG
50 ug
£288.00
RP01700-50UG
100 ug
£431.00
RP01700-100UG
About this Product
- SKU:
- RP01700
- Additional Names:
- Betacellulin|BTC
- Extra Details:
- Recombinant Human Betacellulin/BTC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Tyr111) of human Betacellulin/BTC (Accession #NP_001720.1) fused with and a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Asp32-Tyr111
- Molecular Weight:
- 34.94 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01700




