Recombinant Human Betacellulin/BTC Protein
Product Sizes
10 ug
£145.00
RP01700-10UG
20 ug
£193.00
RP01700-20UG
50 ug
£288.00
RP01700-50UG
100 ug
£431.00
RP01700-100UG
500 ug
£1240.00
RP01700-500UG
1000 ug
£1954.00
RP01700-1000UG
About this Product
- SKU:
- RP01700
- Additional Names:
- Betacellulin|BTC
- Extra Details:
- Betacellulin(BTC) is a member of the epidermal growth factor (EGF) family. These soluble proteins are ligands for one or more of the four receptor tyrosine kinases encoded by the ErbB gene family (ErbB-1/epidermal growth factor receptor (EGFR), neu/ErbB-2/HER2, ErbB-3/HER3 and ErbB-4/HER4). Betacellulin is a 32-kilodalton glycoprotein that appears to be processed from a larger transmembrane precursor by proteolytic cleavage. This protein is a ligand for the EGF receptor. BTC is a polymer of about 62-111 amino acid residues. Secondary Structure: 6% helical (1 helices; 3 residues)36% beta sheet (5 strands; 18 residues). BTC was originally identified as a growth-promoting factor in mouse pancreatic B Beta-cell carcinoma cell line and has since been identified in humans. It plays a role in the growth and development of the neonate and/or mammary gland function. Betacellulin is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
- Formulation:
- Recombinant Human Betacellulin/BTC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Tyr111) of human Betacellulin/BTC (Accession #NP_001720.1
- Immunogen:
- Asp32-Tyr111
- Molecular Weight:
- 45-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01700
