Recombinant Human TNFRSF9/4-1BB/CD137 Protein
Product Sizes
10 ug
£127.00
RP01698-10UG
20 ug
£175.00
RP01698-20UG
50 ug
£240.00
RP01698-50UG
100 ug
£336.00
RP01698-100UG
500 ug
£1002.00
RP01698-500UG
1000 ug
£1574.00
RP01698-1000UG
About this Product
- SKU:
- RP01698
- Additional Names:
- 4-1BB|CD137|CDw137|ILA|TNFRSF9
- Extra Details:
- CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly on activated CD4+ and CD8+ T cells, and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor necrosis factor receptor-associated factors (TRAFs), the adaptor protein which mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses.
- Formulation:
- Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Gln186) of human TNFRSF9/4-1BB/CD137 (Acces
- Immunogen:
- Leu 24 - Gln 186(Q07011-1)
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01698


