Recombinant Human TNFRSF9/4-1BB/CD137 Protein
Product Sizes
10 ug
£127.00
RP01698-10UG
20 ug
£175.00
RP01698-20UG
50 ug
£240.00
RP01698-50UG
100 ug
£336.00
RP01698-100UG
About this Product
- SKU:
- RP01698
- Additional Names:
- 4-1BB|CD137|CDw137|ILA|TNFRSF9
- Extra Details:
- Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Gln186) of human TNFRSF9/4-1BB/CD137 (Accession #NP_002300.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu 24 - Gln 186(Q07011-1)
- Molecular Weight:
- 18.12 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01698
