Recombinant Human Leukemia inhibitory factor/LIF Protein
Product Sizes
10 ug
£145.00
RP01697-10UG
20 ug
£193.00
RP01697-20UG
50 ug
£288.00
RP01697-50UG
100 ug
£431.00
RP01697-100UG
500 ug
£1240.00
RP01697-500UG
1000 ug
£1954.00
RP01697-1000UG
About this Product
- SKU:
- RP01697
- Additional Names:
- CDF|DIA|HILDA|LIF|MLPLI
- Extra Details:
- Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein belonging to the IL-6 family of cytokines. It is involved in growth promotion and cell differentiation of different types of target cells, influence bone metabolism, cachexia, neural development, embryogenesis, and inflammation. LIF has potent proinflammatory properties, being the inducer of the acute phase protein synthesis and affecting cell recruitment into the area of damage or inflammation. LIF is also one of the cytokines that are capable to regulate the differentiation of embryonic stem cells, hematopoietic, and neuronal cells.
- Formulation:
- Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser23-Phe202) of human Leukemia inhibitory factor
- Immunogen:
- Ser23-Phe202
- Molecular Weight:
- 30-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01697


