Recombinant Human Follicle Stimulating Hormone (FSH) (CGA&FSHB) Protein
Product Sizes
20 ug
£223.00
RP01695-20UG
50 ug
£336.00
RP01695-50UG
About this Product
- SKU:
- RP01695
- Additional Names:
- CG-ALPHA&HH24, CGA&FSHB; Follicle Stimulating Hormone (FSH) (CGA&FSHB) |FSHA|GPA1|GPHa|GPHA1|HCG|LHA|TSHA
- Extra Details:
- Recombinant Human Follicle Stimulating Hormone (FSH) (CGA&FSHB) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala 25-Ser116&Asn19-Glu129) of human Follicle Stimulating Hormone (FSH) (CGA&FSHB) (Accession #NP_000726.1&NP_000501.1) fused with and a 6xHis tag at the C-terminus(CGA).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala 25-Ser116&Asn19-Glu129
- Molecular Weight:
- 11.03 (CGA) kDa, 12.49 (FSHB) kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP01695
