Recombinant Human Follicle Stimulating Hormone (FSH) (CGA&FSHB) Protein
Product Sizes
20 ug
£223.00
RP01695-20UG
50 ug
£336.00
RP01695-50UG
500 ug
£1478.00
RP01695-500UG
1000 ug
£2335.00
RP01695-1000UG
About this Product
- SKU:
- RP01695
- Additional Names:
- CG-ALPHA&HH24, CGA&FSHB; Follicle Stimulating Hormone (FSH) (CGA&FSHB) |FSHA|GPA1|GPHa|GPHA1|HCG|LHA|TSHA
- Extra Details:
- Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
- Formulation:
- Recombinant Human Follicle Stimulating Hormone (FSH) (CGA&FSHB) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala 25-Ser116&Asn19-Glu129) of hu
- Immunogen:
- Ala 25-Ser116&Asn19-Glu129
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP01695
