Recombinant Mouse IL-12/IL-12A&IL-12B Protein
Product Sizes
10 ul
£163.00
RP01691-10UL
20 ug
£223.00
RP01691-20UG
50 ug
£336.00
RP01691-50UG
100 ug
£508.00
RP01691-100UG
500 ug
£1716.00
RP01691-500UG
1000 ug
£2716.00
RP01691-1000UG
About this Product
- SKU:
- RP01691
- Additional Names:
- IL-12 p70 (IL12A&IL12B) |Il-12a|Il-12b|IL-12p35&p40|Il-12p40,IL-12&Il12b|IL12|Il12p40|p35
- Extra Details:
- Interleukin 12 (IL-12) is a pleiotropic cytokine that plays an essential role in Th1-type immune response against cancer, a condition where cells in a particular part of the body grow and reproduce uncontrollably.
- Formulation:
- Active Recombinant Mouse IL-12/IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg23-Ala215&Met23-Ser335) of Mouse IL-12A&IL-12B (Ac
- Immunogen:
- Arg23-Ala215&Met23-Ser335
- Molecular Weight:
- 28-30 kDa(IL-12A), 45 kDa(IL-12B)
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01691
