Recombinant Human Erythropoietin/EPO Protein
Product Sizes
10 ug
£163.00
RP01690-10UG
20 ug
£223.00
RP01690-20UG
50 ug
£336.00
RP01690-50UG
100 ug
£508.00
RP01690-100UG
About this Product
- SKU:
- RP01690
- Additional Names:
- DBAL|ECYT5|EP|MVCD2; EPO; Erythropoietin
- Extra Details:
- Recombinant Human Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala28-Arg193) of human Erythropoietin/EPO (Accession #NP_000790.2) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala28-Arg193
- Molecular Weight:
- 18.40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01690








