Recombinant Mouse IL-9 Protein
Product Sizes
10 ug
£193.00
RP01687-10UG
20 ug
£258.00
RP01687-20UG
50 ug
£383.00
RP01687-50UG
100 ug
£586.00
RP01687-100UG
500 ug
£1716.00
RP01687-500UG
1000 ug
£2716.00
RP01687-1000UG
About this Product
- SKU:
- RP01687
- Additional Names:
- Il-9; IL9|P40
- Extra Details:
- Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
- Formulation:
- Recombinant Mouse IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Pro144) of mouse IL9 (Accession #NP_032399.1) fused with and a 6xHis
- Immunogen:
- Gln19-Pro144
- Molecular Weight:
- Approximately 35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01687


