Recombinant Mouse IL-9 Protein
Product Sizes
10 ug
£193.00
RP01687-10UG
20 ug
£258.00
RP01687-20UG
50 ug
£383.00
RP01687-50UG
100 ug
£586.00
RP01687-100UG
About this Product
- SKU:
- RP01687
- Additional Names:
- Il-9; IL9|P40
- Extra Details:
- Recombinant Mouse IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Pro144) of mouse IL9 (Accession #NP_032399.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln19-Pro144
- Molecular Weight:
- 15.01 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01687
