Recombinant Mouse EGF Protein
Product Sizes
50 ug
£127.00
RP01684-50UG
100 ug
£163.00
RP01684-100UG
About this Product
- SKU:
- RP01684
- Additional Names:
- beta-urogastrone, EGF, epidermal growth factor (beta-urogastrone), epidermal growth factor, HOMG4, pro-epidermal growth factor, URG, Urogastrone
- Extra Details:
- Recombinant Mouse EGF Protein is produced by Pichia expression system. The target protein is expressed with sequence (Asn977-Arg1029) of mouse EGF (Accession #NP_034243.2) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Asn977-Arg1029
- Molecular Weight:
- 6.45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01684
