Recombinant Mouse EGF Protein
Product Sizes
50 ug
£127.00
RP01684-50UG
100 ug
£163.00
RP01684-100UG
500 ug
£431.00
RP01684-500UG
1000 ug
£622.00
RP01684-1000UG
About this Product
- SKU:
- RP01684
- Additional Names:
- beta-urogastrone, EGF, epidermal growth factor (beta-urogastrone), epidermal growth factor, HOMG4, pro-epidermal growth factor, URG, Urogastrone
- Extra Details:
- EGF is the founding member of the EGF-family of proteins. Members of this protein family have highly similar structural and functional characteristics. EGF contains 9 EGF-like domains and 9 LDL-receptor class B repeats. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds. As a low-molecular-weight polypeptide, EGF was first purified from the mouse submandibular gland, but since then it was found in many human tissues including submandibular gland, parotid gland.
- Formulation:
- Recombinant Mouse EGF Protein is produced by Pichia expression system. The target protein is expressed with sequence (Asn977-Arg1029) of mouse EGF (Accession #NP_034243.2) fused with no additional ami
- Immunogen:
- Asn977-Arg1029
- Molecular Weight:
- 11 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01684
