Recombinant Mouse B7-H3/CD276 Protein
Product Sizes
10 ug
£127.00
RP01682-10UG
20 ug
£157.00
RP01682-20UG
50 ug
£223.00
RP01682-50UG
100 ug
£336.00
RP01682-100UG
About this Product
- SKU:
- RP01682
- Additional Names:
- 6030411F23Rik; CD276|B7h3|B7RP-2
- Extra Details:
- Recombinant Mouse B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val 29 - Phe 244) of mouse CD276 (Accession #NP_598744.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val 29 - Phe 244
- Molecular Weight:
- 24.33 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01682
