Recombinant Mouse IL-4R alpha/CD124 Protein
Product Sizes
10 ug
£127.00
RP01680-10UG
20 ug
£175.00
RP01680-20UG
50 ug
£240.00
RP01680-50UG
100 ug
£336.00
RP01680-100UG
500 ug
£1002.00
RP01680-500UG
1000 ug
£1574.00
RP01680-1000UG
About this Product
- SKU:
- RP01680
- Additional Names:
- CD124; IL-4R|Il4r
- Extra Details:
- CD124, also known as the interleukin 4 receptor (IL4R), is a typeI transmembrane protein that can regulate IgE antibody production in B cells through binding to interleukin 4 and interleukin 13 and promote differentiation of Th2 cells through binding to interleukin 4. The membrane-bound form of CD124 can be hydrolyzed to a soluble form which can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells.
- Formulation:
- Recombinant Mouse IL-4R alpha/CD124 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile 26 - Arg 233) of mouse IL4R (Accession #NP_001008700.1) fu
- Immunogen:
- Ile 26 - Arg 233
- Molecular Weight:
- 35-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01680
