Recombinant Mouse LILRB4/ILT-3/CD85k Protein
Product Sizes
10 ug
£145.00
RP01679-10UG
20 ug
£193.00
RP01679-20UG
50 ug
£288.00
RP01679-50UG
About this Product
- SKU:
- RP01679
- Additional Names:
- CD85K|gp49|Gp49b|HM18|ILT3|Lilrb4|LIR-5
- Extra Details:
- Recombinant Mouse LILRB4/ILT-3/CD85k Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys238) of mouse LILRB4 (Accession #NP_038560.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly24-Lys238
- Molecular Weight:
- 24.87 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01679




