Recombinant Human S100-A10 Protein
Product Sizes
10 ug
£133.00
RP01677LQ-10UG
20 ug
£181.00
RP01677LQ-20UG
50 ug
£240.00
RP01677LQ-50UG
100 ug
£353.00
RP01677LQ-100UG
About this Product
- SKU:
- RP01677LQ
- Additional Names:
- 42C|ANX2L|ANX2LG; S100A10|Ca[1]|CAL1L|CLP11|GP11|p10|P11
- Extra Details:
- Recombinant Human S100-A10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys97) of human S100A10 (Accession #NP_002957.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Supplied as a 0.22 um filtered solution in 20mM Tris 10% Glycerol, PH8.5
- Immunogen:
- Met1-Lys97
- Molecular Weight:
- 12.04 kDa
- Purity:
- ≥90%
- Sequence:
- MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01677LQ




