Recombinant Mouse IL-15 Protein
Product Sizes
10 ug
£193.00
RP01676-10UG
20 ug
£258.00
RP01676-20UG
50 ug
£383.00
RP01676-50UG
100 ug
£586.00
RP01676-100UG
About this Product
- SKU:
- RP01676
- Additional Names:
- Il15, Interleukin-15, IL-15
- Extra Details:
- Recombinant Mouse IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of mouse IL-15 (Accession #NP_001241676.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Asn49-Ser162
- Molecular Weight:
- 14.09 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01676
