Recombinant Rat CD47 Protein
Product Sizes
10 ug
£127.00
RP01669-10UG
20 ug
£175.00
RP01669-20UG
50 ug
£240.00
RP01669-50UG
100 ug
£336.00
RP01669-100UG
About this Product
- SKU:
- RP01669
- Additional Names:
- Itgp; CD47
- Extra Details:
- Recombinant Rat CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 19 - Lys 140) of rat CD47 (Accession #NP_062068.1) fused with and a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln 19 - Lys 140
- Molecular Weight:
- 39.72 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01669
