Recombinant Rat CD47 Protein
Product Sizes
10 ug
£127.00
RP01669-10UG
20 ug
£175.00
RP01669-20UG
50 ug
£240.00
RP01669-50UG
100 ug
£336.00
RP01669-100UG
500 ug
£1002.00
RP01669-500UG
1000 ug
£1574.00
RP01669-1000UG
About this Product
- SKU:
- RP01669
- Additional Names:
- Itgp; CD47
- Extra Details:
- CD47 contains 1 Ig-like V-type (immunoglobulin-like) domain and is a receptor for the C-terminal cell binding domain of thrombospondin. It may play a role in membrane transport and signal transduction. CD47 is also a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. It is very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. CD47 may play a role in membrane transport and/or integrin dependent signal transduction. It may prevent premature elimination of red blood cells. It also may be involved in membrane permeability changes induced following virus infection. By acting as an adhesion receptor for THBS1 on platelets, CD47 plays a role in both cell adhesion and in the modulation of integrins. It also plays an important role in memory formation and synaptic plasticity in the hippocampus.
- Formulation:
- Recombinant Rat CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 19 - Lys 140) of rat CD47 (Accession #NP_062068.1) fused with and a hFc t
- Immunogen:
- Gln 19 - Lys 140
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01669


