Recombinant Rat Cystatin-C/CST3 Protein
Product Sizes
10 ug
£163.00
RP01668-10UG
20 ug
£223.00
RP01668-20UG
50 ug
£336.00
RP01668-50UG
100 ug
£508.00
RP01668-100UG
About this Product
- SKU:
- RP01668
- Additional Names:
- CYSC; Cystatin-C; CST3
- Extra Details:
- Recombinant Rat Cystatin-C/CST3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 21-Ala140) of rat Cystatin-C/CST3 (Accession #NP_036969.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM HEPES and 150 mM NaCl, pH 7.0
- Immunogen:
- Gly 21-Ala140
- Molecular Weight:
- 14.17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01668
