Recombinant Mouse TFPI Protein
Product Sizes
10 ug
£163.00
RP01667-10UG
20 ug
£223.00
RP01667-20UG
50 ug
£336.00
RP01667-50UG
100 ug
£508.00
RP01667-100UG
About this Product
- SKU:
- RP01667
- Additional Names:
- A630013F22Rik; TFPI|EPI|LACI
- Extra Details:
- Recombinant Mouse TFPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 29-Asn306) of mouse TFPI (Accession #NP_035706.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu 29-Asn306
- Molecular Weight:
- 32.53 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKVVYESIN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01667
