Recombinant Mouse B7-DC/PD-L2/CD273 Protein
Product Sizes
10 ug
£127.00
RP01666-10UG
20 ug
£157.00
RP01666-20UG
50 ug
£223.00
RP01666-50UG
100 ug
£336.00
RP01666-100UG
About this Product
- SKU:
- RP01666
- Additional Names:
- B7-DC|Btdc|F730015O22Rik; PDCD1LG2; CD273|PD-L2
- Extra Details:
- Recombinant Mouse B7-DC/PD-L2/CD273 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Arg219) of mouse B7-DC/PD-L2/CD273 (Accession #NP_067371.1) fused with and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu20-Arg219
- Molecular Weight:
- 23.38 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01666
