Recombinant Mouse IL-12B/IL-12 p40 Protein
Product Sizes
10 ug
£145.00
RP01661-10UG
20 ug
£193.00
RP01661-20UG
50 ug
£264.00
RP01661-50UG
100 ug
£395.00
RP01661-100UG
500 ug
£1157.00
RP01661-500UG
1000 ug
£1812.00
RP01661-1000UG
About this Product
- SKU:
- RP01661
- Additional Names:
- Il-12b|Il-12p40|IL12B|Il12p40|p40
- Extra Details:
- Subunit beta of interleukin 12 (also known as natural killer cell stimulatory factor 2, or cytotoxic lymphocyte maturation factor 2, p40) (IL12B) is a subunit of human interleukin 12. IL12B/IL-12B is a cytokine that acts on T and natural killer cells and has a broad array of biological activities.
- Formulation:
- Recombinant Mouse IL-12B/IL-12 p40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met23-Ser335) of mouse IL-12B (Accession #NP_001152896.1) fused
- Immunogen:
- Met23-Ser335
- Molecular Weight:
- 45-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01661


